PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G016900.1.p
Common NameGLYMA_08G016900, LOC100792789
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 647aa    MW: 72756.2 Da    PI: 6.9261
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G016900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-094414781954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps  ++  LA+++gL+++qV++WF N R +
  Glyma.08G016900.1.p 441 FEHflHPYPSDVDKHILARQTGLSKSQVSNWFINARVR 478
                          554459******************************88 PP

2BELL115.72.4e-37302372272
                 BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          + elqk+k++Ll +leeVd+rYk+y++q+++v+ssFeavag g+a++Y +lAlka+SrhFrcLkd i++qi
  Glyma.08G016900.1.p 302 FVELQKRKTRLLAMLEEVDRRYKHYRDQMKAVMSSFEAVAGNGAATVYSALALKAMSRHFRCLKDGIMDQI 372
                          679*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.4E-55241370IPR006563POX domain
PfamPF075264.9E-45247368IPR006563POX domain
PROSITE profilePS5007112.147419482IPR001356Homeobox domain
SMARTSM003894.6E-9422486IPR001356Homeobox domain
CDDcd000861.96E-11422483No hitNo description
SuperFamilySSF466895.99E-17423488IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27425488IPR009057Homeodomain-like
PfamPF059201.3E-17439478IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MARQLCEDKS KDMASSTHHG LFYSDVSSHN QTIQSHLMNH IQGFVTETDP EMFNLTTGME  60
MIGFSKNLEQ NSESNGVMWK SFFCKPGQHA GPSSSKTMNE SCSNFYNHQH DHKYNKQDFT  120
SGINSETSTD NLVVGGAHDS APWQENRLMV DDSSLRCVFP CEGNERPSQG LSLSLSSTNP  180
SGIGLQSFEL RQTTSHHHHQ QHLSDFVSRE GFFGKPVNAQ QQQEMLQDGY LSPNKAANIY  240
QQGHFLIKNS KFLVPSQVLL NEFCSLGTKE NDVPKQKNKQ WEEGNNNGGG SSKNHSLSSL  300
EFVELQKRKT RLLAMLEEVD RRYKHYRDQM KAVMSSFEAV AGNGAATVYS ALALKAMSRH  360
FRCLKDGIMD QIRATRKGMG EKELAAVPGT TRGETPRLKI IDQSLRQQRA FQQISIMETH  420
PWRPQRGLPE RSVSVLRAWL FEHFLHPYPS DVDKHILARQ TGLSKSQVSN WFINARVRLW  480
KPMVEEMYLE EEKEHQNDVA SSEGGGINIL GDQKPTQARL VRIDSECMSS IVNNPDDKND  540
TKSGKTIQND NQMDAFGSVE LDFWSYTHQY SSGHSGGVSL TLGLQQHGES GVSLAFPPAA  600
TQSSMFYPRD QIEDCQTVQY SLVDGKGQNM PYRNLMGTHL LHDHLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15428486563Homeobox protein Meis2
3k2a_B1e-15428486563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.339710.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003532909.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-139BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLI1KPE20.0I1KPE2_SOYBN; Uncharacterized protein
STRINGGLYMA08G02020.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-131TALE family protein